HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BGC6

Names and origin
Entry : T2BGC6 (unreviewed)
Entry name : T2BGC6_HAEIF
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : tusA
ORF names : HifGL_000179
EC number : 2.8.1.-
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cytoplasm; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Protein sequence
Length : 87 residues
>T2BGC6|T2BGC6_HAEIF Haemophilus influenzae KR494
MSEISVTQILDALGLRCPEPVMLVRKNIRHLNDGEILLVIADDPATTRDIPSFCQFMDHT
LLQSEVEKPPFKYWVKKGK