HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BG89

Names and origin
Entry : T2BG89 (unreviewed)
Entry name : T2BG89_HAEIF
Protein names : ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : atpH
ORF names : HifGL_000144
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell membrane; Hydrogen ion transport; Hydrolase; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase delta chain family
Subcellular location : Cell membrane; Peripheral membrane protein.
Protein sequence
Length : 189 residues
>T2BG89|T2BG89_HAEIF Haemophilus influenzae KR494
MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNAT
QIEKIATAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANELQL