HIGDB - Haemophilus influenzae Genome Database

Protein search results for - T2BFZ2

Names and origin
Entry : T2BFZ2 (unreviewed)
Entry name : T2BFZ2_HAEIF
Protein names : Disulfide bond formation protein B (Disulfide oxidoreductase)
Organism : Haemophilus influenzae KR494
Organism ID : 1334187
Gene names : dsbB
ORF names : HifGL_000049
History
Date of creation : 2013-11-13
Date of modification : 2013-12-11
Date of sequence modification : 2013-11-13
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Cell membrane; Chaperone; Disulfide bond; Electron transport; Membrane; Oxidoreductase; Redox-active center; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to DsbB family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Protein sequence
Length : 189 residues
>T2BFZ2|T2BFZ2_HAEIF Haemophilus influenzae KR494
MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII
ALLQPRVFILRLIALVLGLFSSIKGLLISFRHLDLQINPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN