HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q57534

Names and origin
Entry : Q57534 (reviewed)
Entry name : VAPB1_HAEIN
Protein names : Antitoxin VapB1
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : vapB1
ORF names : HI_0321
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : DNA binding
GO identifier : GO:0003677
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Reference proteome
General annotation
Domains : AbrB-like domain (1)
Sequence similarities : Belongs to VapB family
Reference
PubMed ID : 7542800; 10675023
Protein sequence
Length : 86 residues
>Q57534|VAPB1_HAEIN Haemophilus influenzae Rd KW20
MLTKVFQSGNSQAVRIPMDFRFDVDTVEIFRKENGDVVLRPVSKKTDDFLALFEGFDETF
IQALEARDDLPPQERENL