HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q57392

Names and origin
Entry : Q57392 (reviewed)
Entry name : Y414_HAEIN
Protein names : Uncharacterized protein HI_0414
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0414
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell outer membrane; integral to membrane; porin activity
GO identifier : GO:0009279; GO:0016021; GO:0015288
Keywords
Ligand & Biological process : Complete proteome; Reference proteome
General annotation
Sequence similarities : Belongs to Opacity porin family
Reference
PubMed ID : 7542800
Protein sequence
Length : 78 residues
>Q57392|Y414_HAEIN Haemophilus influenzae Rd KW20
MPIGGDVKADQETSGSRSIKRIGFGFIGGIGYDITPNITLDLGYRYNDWGRLENVRFKTH
EASFGVRYRF