HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q57380

Names and origin
Entry : Q57380 (reviewed)
Entry name : Y1475_HAEIN
Protein names : Putative uncharacterized protein HI_1475
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1475
History
Date of creation : 2001-06-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Uncertain
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Domains : ABC transmembrane type-1 domain (1)
Sequence similarities : Belongs to Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 127 residues
>Q57380|Y1475_HAEIN Haemophilus influenzae Rd KW20
MVFNMRSTRGIFSSFESGYRFASYTLELSPFKTLIKIEIPMCWKPLVCASVLAWSRAIGE
FGATLMLAGATRFKTETLPMAVYLNISSGDFEIAIGASLWLLFISSCLLLVLRMINRAV