HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q57223

Names and origin
Entry : Q57223 (reviewed)
Entry name : Y1314_HAEIN
Protein names : Probable endopeptidase HI_1314 (EC 3.4.-.-)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1314
EC number : 3.4.-.-
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cysteine-type peptidase activity; plasma membrane; proteolysis
GO identifier : GO:0008234; GO:0005886; GO:0006508
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Hydrolase; Lipoprotein; Membrane; Palmitate; Protease; Reference proteome; Signal; Thiol protease
General annotation
Sequence similarities : Belongs to Peptidase C40 family
Subcellular location : Cell membrane; Lipid-anchor.
Reference
PubMed ID : 7542800
Protein sequence
Length : 173 residues
>Q57223|Y1314_HAEIN Haemophilus influenzae Rd KW20
MKVYKSFLIATASLFLFACSSFQNDDYAMNYKGQIGEPIMAIAMLSEQQHEWAGTPYVLG
GVSRRGVDCSGFVQKTFFDRFNLRLPRSTVEQANYGKHVRKEDIQTGDLIFFKTGRGPNG
YHVGIYVKEDKFLHASTRGGVVYSSMNNPYWSKAFWQVRRI