HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q57194

Names and origin
Entry : Q57194 (reviewed)
Entry name : TUSC_HAEIN
Protein names : Protein TusC homolog
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : tusC
ORF names : HI_0576.1
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm
GO identifier : GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Reference proteome
General annotation
Sequence similarities : Belongs to DsrF/TusC family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800;
Protein sequence
Length : 127 residues
>Q57194|TUSC_HAEIN Haemophilus influenzae Rd KW20
MKIAFLFRTSPHGTSISREGLDAILAATAFCEPNDIGIFFIDDGVLNLIDNQQPEIIQQK
DFIRTFKLLDLYDVEQRFICTASLQKFKLDNRELILSCEKIDRSLLLEKLNQAGKLFTF