HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q57089

Names and origin
Entry : Q57089 (reviewed)
Entry name : Y1251_HAEIN
Protein names : Uncharacterized HTH-type transcriptional regulator HI_1251
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_1251
History
Date of creation : 1997-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1996-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : regulation of transcription, DNA-dependent; sequence-specific DNA binding; transcription, DNA-dependent
GO identifier : GO:0006355; GO:0043565; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Reference proteome; Transcription; Transcription regulation
General annotation
Domains : HTH cro/C1-type DNA-binding domain (1)
Sequence similarities : Belongs to VapA/VapI family
Reference
PubMed ID : 7542800
Protein sequence
Length : 115 residues
>Q57089|Y1251_HAEIN Haemophilus influenzae Rd KW20
MMTRKPTSVGEILQEEFLEPLSLKISDLAQILDVHRNTASNIVNNSSRITLEMAVKLAKV
FDTTPEFWLNLQTRIDLWDLEHNKRFQQSLANVKPALHRHDTSTFAM