HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QPP0

Names and origin
Entry : Q4QPP0 (reviewed)
Entry name : YBEY_HAEI8
Protein names : Endoribonuclease YbeY (EC 3.1.-.-)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : ybeY
ORF names : NTHI0004
EC number : 3.1.-.-
History
Date of creation : 2006-02-07
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; endoribonuclease activity; metalloendopeptidase activity; nucleic acid phosphodiester bond hydrolysis; rRNA processing; zinc ion binding
GO identifier : GO:0005737; GO:0004521; GO:0004222; GO:0090305; GO:0006364; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Metal-binding; Nuclease; Ribosome biogenesis; Zinc; rRNA processing
General annotation
Sequence similarities : Belongs to Endoribonuclease YbeY family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 166 residues
>Q4QPP0|YBEY_HAEI8 Haemophilus influenzae 86-028NP
MGSVLVDLQIATENIEGLPTEEQIVQWATGAVQPEGNEVEMTVRIVDEAESHELNLTYRG
KDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAAEQEKPLMAHWAHMVVHGCLHLL
GYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK