HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QPM0

Names and origin
Entry : Q4QPM0 (reviewed)
Entry name : CITD_HAEI8
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : citD
ORF names : NTHI0031
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm
GO identifier : GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 103 residues
>Q4QPM0|CITD_HAEI8 Haemophilus influenzae 86-028NP
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKAAAMRATDETINWEAVL