HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QPL0

Names and origin
Entry : Q4QPL0 (unreviewed)
Entry name : Q4QPL0_HAEI8
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rsfS
ORF names : NTHI0042
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; mature ribosome assembly; negative regulation of ribosome biogenesis; negative regulation of translation
GO identifier : GO:0005737; GO:0042256; GO:0090071; GO:0017148
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 110 residues
>Q4QPL0|Q4QPL0_HAEI8 Haemophilus influenzae 86-028NP
MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQRDAREMYQLEKLWA