HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QPG1

Names and origin
Entry : Q4QPG1 (unreviewed)
Entry name : Q4QPG1_HAEI8
Protein names : Thioredoxin
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : trxA
ORF names : NTHI0098
History
Date of creation : 2005-07-19
Date of modification : 2013-12-11
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; glycerol ether metabolic process; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0006662; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to Thioredoxin family
Reference
PubMed ID : 15968074
Protein sequence
Length : 115 residues
>Q4QPG1|Q4QPG1_HAEI8 Haemophilus influenzae 86-028NP
MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV
DDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALPKTQLANFINQHI