HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QP29

Names and origin
Entry : Q4QP29 (reviewed)
Entry name : RL32_HAEI8
Protein names : 50S ribosomal protein L32
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rpmF
ORF names : NTHI0248
History
Date of creation : 2006-03-07
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L32P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 60 residues
>Q4QP29|RL32_HAEI8 Haemophilus influenzae 86-028NP
MAVQQNKKSRSRRDMRRSHDALTTAAVSVDKASGETHLRHHVTADGYYRGRKVINK