HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QP03

Names and origin
Entry : Q4QP03 (reviewed)
Entry name : TATB_HAEI8
Protein names : Sec-independent protein translocase protein TatB
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : tatB
ORF names : NTHI0280
History
Date of creation : 2007-09-11
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : TAT protein transport complex; integral to plasma membrane; protein secretion; protein transmembrane transporter activity; protein transport by the Tat complex
GO identifier : GO:0033281; GO:0005887; GO:0009306; GO:0008320; GO:0043953
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to TatB family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 202 residues
>Q4QP03|TATB_HAEI8 Haemophilus influenzae 86-028NP
MFDIGFSELILLMVLGLVVLGPKRLPIAIRTVMDWVKTIRGLAANVQNELKQELKLQELQ
DSIKKAESLNLQALSPELSKTVEELKAQADKMKAELEDKAAQAGTTVEDQIKEIKNAAEN
AEKPQNAISVEEAAETLSEAEKTPTDLTALETHEKVELNTHLSSYYPPDDIEIAPASKSQ
SSKTKS