HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QNY9

Names and origin
Entry : Q4QNY9 (reviewed)
Entry name : RL19_HAEI8
Protein names : 50S ribosomal protein L19
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rplS
ORF names : NTHI0298
History
Date of creation : 2006-03-07
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L19P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 124 residues
>Q4QNY9|RL19_HAEI8 Haemophilus influenzae 86-028NP
MSNIIKQLEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEGVVIAIRNRGLHSAFT
LRKVSNGVGVERVFQTHSPAVDSIAVKRKGAVRKAKLYYLRERSGKSARIKERLGA