HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QNP9

Names and origin
Entry : Q4QNP9 (reviewed)
Entry name : METJ_HAEI8
Protein names : Met repressor (Met regulon regulatory protein MetJ)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : metJ
ORF names : NTHI0404
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; methionine biosynthetic process; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0005737; GO:0009086; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Complete proteome; Cytoplasm; DNA-binding; Methionine biosynthesis; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to MetJ family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 113 residues
>Q4QNP9|METJ_HAEI8 Haemophilus influenzae 86-028NP
MADWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQLKSLRHATNSELLCE
AFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMRELGVDPESWEY