HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QNN8

Names and origin
Entry : Q4QNN8 (reviewed)
Entry name : RUVX_HAEI8
Protein names : Putative Holliday junction resolvase (EC 3.1.-.-)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI0416
EC number : 3.1.-.-
History
Date of creation : 2006-10-31
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA recombination; DNA repair; cytoplasm; nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0006310; GO:0006281; GO:0005737; GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA damage; DNA recombination; DNA repair; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to YqgF HJR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 151 residues
>Q4QNN8|RUVX_HAEI8 Haemophilus influenzae 86-028NP
MGITALAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAIEKCLKEWKPDVVIVG
LPLNMDGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGK
IDGVSACLILESWFEYAEY