HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QNK3

Names and origin
Entry : Q4QNK3 (unreviewed)
Entry name : Q4QNK3_HAEI8
Protein names : Nitrogen regulatory protein P-II
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : glnB
ORF names : NTHI0456
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to P(II) protein family
Reference
PubMed ID : 15968074
Protein sequence
Length : 120 residues
>Q4QNK3|Q4QNK3_HAEI8 Haemophilus influenzae 86-028NP
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIVETAQTGKIGDGKIFVYHVERAIRIRTGEENEDAI