HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QND2

Names and origin
Entry : Q4QND2 (reviewed)
Entry name : HFQ_HAEI8
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : hfq
ORF names : NTHI0535
History
Date of creation : 2006-12-12
Date of modification : 2013-12-11
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003723; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Reference
PubMed ID : 15968074
Protein sequence
Length : 99 residues
>Q4QND2|HFQ_HAEI8 Haemophilus influenzae 86-028NP
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTTPTEAVENVETQAE