HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QN61

Names and origin
Entry : Q4QN61 (reviewed)
Entry name : ATPD_HAEI8
Protein names : ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : atpH
ORF names : NTHI0612
History
Date of creation : 2009-07-28
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1)
GO identifier : GO:0005886; GO:0042777; GO:0046933; GO:0045261
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase delta chain family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 189 residues
>Q4QN61|ATPD_HAEI8 Haemophilus influenzae 86-028NP
MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNAT
QIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANELQL