HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QN58

Names and origin
Entry : Q4QN58 (reviewed)
Entry name : ATP6_HAEI8
Protein names : ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : atpB
ORF names : NTHI0615
History
Date of creation : 2009-02-10
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, coupling factor F(o)
GO identifier : GO:0016021; GO:0005886; GO:0042777; GO:0046933; GO:0045263
Keywords
Ligand & Biological process : ATP synthesis; CF(0); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ATPase A chain family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 282 residues
>Q4QN58|ATP6_HAEI8 Haemophilus influenzae 86-028NP
MSGQTTSEYISHHLSFLKTGDGFWNVHIDTLFFSILAAVIFLFVFSRVGKKATTGVPGKM
QCLVEIVVEWVNGIVKENFHGPRNVVAPLALTIFCWVFIMNAIDLIPVDFLPQFAGLFGI
HYLRAVPTADISATLGMSICVFFLILFYTIKSKGFKGLVKEYTLHPFNHWAFIPVNFILE
TVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANMAIAALGIPLHLAWAIFHILVITL
QAFIFMMLTVVYLSIAYNKADH