HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QN45

Names and origin
Entry : Q4QN45 (reviewed)
Entry name : RBSD_HAEI8
Protein names : D-ribose pyranase (EC 5.5.1.n1)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rbsD
ORF names : NTHI0629
EC number : 5.5.1.n1
History
Date of creation : 2008-09-02
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : D-ribose catabolic process; cytoplasm; intramolecular lyase activity; monosaccharide binding
GO identifier : GO:0019303; GO:0005737; GO:0016872; GO:0048029
Keywords
Ligand & Biological process : Carbohydrate metabolism; Complete proteome; Cytoplasm; Isomerase
General annotation
Pathway : Carbohydrate metabolism; D-ribose degradation; D-ribose 5-phosphate from beta-D-ribopyranose: step 1/2.
Sequence similarities : Belongs to RbsD / FucU family, RbsD subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 151 residues
>Q4QN45|RBSD_HAEI8 Haemophilus influenzae 86-028NP
MKKTMLLNAQLSRCIASVGHTESLTICDAGLPIPLSVERIDLALTAGVPSFLQTLNVVTN
EMYVERVVIAEEIKEKNPEILTALLTQLQQLESHQGNQIQVEFVSHETFKKFTLESKAIV
RTGECSPYANVILYSGVPF