HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QN02

Names and origin
Entry : Q4QN02 (reviewed)
Entry name : PRIB_HAEI8
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : priB
ORF names : NTHI0672
History
Date of creation : 2008-05-20
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : Complete proteome; DNA replication; DNA-binding; Primosome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Reference
PubMed ID : 15968074
Protein sequence
Length : 116 residues
>Q4QN02|PRIB_HAEI8 Haemophilus influenzae 86-028NP
MLKSNLKIDNRFSVMGVVSQLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQ
ISGNQLIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID