HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QN00

Names and origin
Entry : Q4QN00 (reviewed)
Entry name : IF1_HAEI8
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : infA
ORF names : NTHI0674
History
Date of creation : 2006-12-12
Date of modification : 2013-11-13
Date of sequence modification : 2006-12-12
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 80 residues
>Q4QN00|IF1_HAEI8 Haemophilus influenzae 86-028NP
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR