HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMW0

Names and origin
Entry : Q4QMW0 (reviewed)
Entry name : MSCL_HAEI8
Protein names : Large-conductance mechanosensitive channel
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : mscL
ORF names : NTHI0721
History
Date of creation : 2006-05-30
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; ion channel activity; plasma membrane
GO identifier : GO:0016021; GO:0005216; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Ion channel; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to MscL family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 140 residues
>Q4QMW0|MSCL_HAEI8 Haemophilus influenzae 86-028NP
MNFIKEFREFAMRGNVVDMAIGVIIGSAFGKIVSSLVSDIFTPVLGILTGGIDFKDMKFV
LAQAQGDVPAVTLNYGLFIQNVIDFIIIAFAIFMMIKVINKVRKPEEKKTAPKAETLLTE
IRDLLKNK