HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMV0

Names and origin
Entry : Q4QMV0 (reviewed)
Entry name : CRCB_HAEI8
Protein names : Putative fluoride ion transporter CrcB
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : crcB
ORF names : NTHI0731
History
Date of creation : 2006-10-17
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : inorganic anion transmembrane transporter activity; inorganic anion transport; integral to plasma membrane
GO identifier : GO:0015103; GO:0015698; GO:0005887
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to CrcB (TC 9.B.71) family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 140 residues
>Q4QMV0|CRCB_HAEI8 Haemophilus influenzae 86-028NP
MQALLFISYGAILGASLRWAIGLLFNPLFSSFAFGTLIANLLGCLIIGVLLGFFWQFPQI
SSEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMMHLFGCLAMTVLGIWIY
KICSQLLS