HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMT3

Names and origin
Entry : Q4QMT3 (unreviewed)
Entry name : Q4QMT3_HAEI8
Protein names : Predicted chloride channel protein
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI0751
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : ion channel activity
GO identifier : GO:0005216
Keywords
Ligand & Biological process : Complete proteome
Reference
PubMed ID : 15968074
Protein sequence
Length : 64 residues
>Q4QMT3|Q4QMT3_HAEI8 Haemophilus influenzae 86-028NP
MEMTGAQLVLIWLLISSIIASIISRQFSPKPFYHFAAGRFRQQMQARQAEELRSKTKQEK