HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMP8

Names and origin
Entry : Q4QMP8 (reviewed)
Entry name : ZAPB_HAEI8
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : zapB
ORF names : NTHI0790
History
Date of creation : 2008-05-20
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 80 residues
>Q4QMP8|ZAPB_HAEI8 Haemophilus influenzae 86-028NP
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV