HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMP3

Names and origin
Entry : Q4QMP3 (reviewed)
Entry name : FTSB_HAEI8
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : ftsB
ORF names : NTHI0795
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell division site; cytokinesis by binary fission; integral to plasma membrane
GO identifier : GO:0032153; GO:0043093; GO:0005887
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 100 residues
>Q4QMP3|FTSB_HAEI8 Haemophilus influenzae 86-028NP
MRLLILILLSVLVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGL
TKGFEAIEERARMQHGLVKENEVFYHIVKESK