HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMJ8

Names and origin
Entry : Q4QMJ8 (reviewed)
Entry name : TUSA_HAEI8
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : tusA
ORF names : NTHI0853
EC number : 2.8.1.-
History
Date of creation : 2005-09-13
Date of modification : 2013-11-13
Date of sequence modification : 2005-09-13
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity
GO identifier : GO:0005737; GO:0016783
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 87 residues
>Q4QMJ8|TUSA_HAEI8 Haemophilus influenzae 86-028NP
MSEISVTQTLNTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHT
LLQSEVEKPPFKYWVKRGK