HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMJ5

Names and origin
Entry : Q4QMJ5 (reviewed)
Entry name : PSIE_HAEI8
Protein names : Protein PsiE homolog
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : psiE
ORF names : NTHI0856
History
Date of creation : 2005-09-13
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cellular response to phosphate starvation; integral to membrane; plasma membrane
GO identifier : GO:0016036; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to PsiE family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 151 residues
>Q4QMJ5|PSIE_HAEI8 Haemophilus influenzae 86-028NP
MEESLELEKLPRIITDVLKIVLCTALIALAIVLIIALVKITYTLSMMVLNTSSVVPYDVA
EQAVMFFLYFGFIGLIVQYFKSGYHFPLRYFIYAGITAMLRLIIVNHESSVDTILFAGAI
LIMVIALCLVLYSNKLKNI