HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMI4

Names and origin
Entry : Q4QMI4 (reviewed)
Entry name : FUCM_HAEI8
Protein names : L-fucose mutarotase (EC 5.1.3.n2) (Fucose 1-epimerase) (Type-2 mutarotase)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : fucU
ORF names : NTHI0867
EC number : 5.1.3.n2
History
Date of creation : 2008-07-22
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : L-fucose metabolic process; cytoplasm; fucose binding; racemase and epimerase activity, acting on carbohydrates and derivatives
GO identifier : GO:0042354; GO:0005737; GO:0042806; GO:0016857
Keywords
Ligand & Biological process : Carbohydrate metabolism; Complete proteome; Cytoplasm; Fucose metabolism; Isomerase
General annotation
Pathway : Carbohydrate metabolism; L-fucose metabolism.
Sequence similarities : Belongs to RbsD / FucU family, FucU mutarotase subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 156 residues
>Q4QMI4|FUCM_HAEI8 Haemophilus influenzae 86-028NP
MLKGIHPALSPELLKTLAEMGHGDEIVLADAHFPAHSLHKNVIRADGISIDILLEAITPL
FEFDAYVDAPLLMMKAVEGDSLDPNVETRYLNAIESAVGFTPNLTSLERFDFYTRAKQAY
AVVVSGEIAKYGNIIIKKGVTPIL