HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QME1

Names and origin
Entry : Q4QME1 (reviewed)
Entry name : RL31_HAEI8
Protein names : 50S ribosomal protein L31
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rpmE
ORF names : NTHI0917
History
Date of creation : 2006-10-31
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : metal ion binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0046872; GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; RNA-binding; Ribonucleoprotein; Ribosomal protein; Zinc; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L31P family, Type A subfamily
Reference
PubMed ID : 15968074
Protein sequence
Length : 78 residues
>Q4QME1|RL31_HAEI8 Haemophilus influenzae 86-028NP
MKQGIHPEYKEVTATCSCGNVIKTRSTLGKDINLDVCGNCHPFYTGKQRVVDTGGRVERF
NSRFKIPSTK