HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMC0

Names and origin
Entry : Q4QMC0 (reviewed)
Entry name : RL23_HAEI8
Protein names : 50S ribosomal protein L23
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rplW
ORF names : NTHI0940
History
Date of creation : 2007-01-23
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nucleotide binding; rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0000166; GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L23P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 107 residues
>Q4QMC0|RL23_HAEI8 Haemophilus influenzae 86-028NP
MSQERLLSVLRAPHISEKATNNAEKSNTVVLKVALDANKAEIAAAVAQLFEVKVDSVRTV
VVKGKTKRRGNKMGRRSDWKKAYVTLAEGQNLDFVDSAE