HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMB0

Names and origin
Entry : Q4QMB0 (reviewed)
Entry name : RL24_HAEI8
Protein names : 50S ribosomal protein L24
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rplX
ORF names : NTHI0952
History
Date of creation : 2006-06-27
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L24P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 111 residues
>Q4QMB0|RL24_HAEI8 Haemophilus influenzae 86-028NP
MAAKIRQNDEVIVLTGKDKGKRGKVTKVLPNGKVFVEGINIITKHEKPVPALGKAGGLVK
KEAAIDASNVAIFNPKTNKADRVGFRFEDGKKVRFFKSNNEII