HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMA3

Names and origin
Entry : Q4QMA3 (reviewed)
Entry name : RL30_HAEI8
Protein names : 50S ribosomal protein L30
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rpmD
ORF names : NTHI0959
History
Date of creation : 2007-01-23
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : large ribosomal subunit; structural constituent of ribosome; translation
GO identifier : GO:0015934; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L30P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 63 residues
>Q4QMA3|RL30_HAEI8 Haemophilus influenzae 86-028NP
MAKTIKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVRGMINQVSYMVKVEE