HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QMA0

Names and origin
Entry : Q4QMA0 (reviewed)
Entry name : RS13_HAEI8
Protein names : 30S ribosomal protein S13
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : rpsM
ORF names : NTHI0962
History
Date of creation : 2006-04-04
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0000049; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding; tRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S13P family
Reference
PubMed ID : 15968074
Protein sequence
Length : 126 residues
>Q4QMA0|RS13_HAEI8 Haemophilus influenzae 86-028NP
MARIAGINIPDHKHAVIALTAIYGIGKTRSQAICAAAGIAEDVKIRELSEEQIDKLRDEV
GKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKTNARTRKGPRKPIKK