HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QM87

Names and origin
Entry : Q4QM87 (reviewed)
Entry name : CSRA_HAEI8
Protein names : Carbon storage regulator homolog
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : csrA
ORF names : NTHI0977
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; mRNA catabolic process; regulation of carbohydrate metabolic process
GO identifier : GO:0003723; GO:0006402; GO:0006109
Keywords
Ligand & Biological process : Complete proteome; RNA-binding
General annotation
Sequence similarities : Belongs to CsrA family
Reference
PubMed ID : 15968074
Protein sequence
Length : 71 residues
>Q4QM87|CSRA_HAEI8 Haemophilus influenzae 86-028NP
MLILTRKVGESVLIGDDISITVLSVRGNQVKLGVEAPKEVSVHREEIYQRIKQTKDEPYL
GSS