HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QM69

Names and origin
Entry : Q4QM69 (unreviewed)
Entry name : Q4QM69_HAEI8
Protein names : Monofunctional biosynthetic peptidoglycan transglycosylase (EC 2.4.2.-)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : mtgA
ORF names : NTHI0997
EC number : 2.4.2.-
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; peptidoglycan biosynthetic process; peptidoglycan-based cell wall; plasma membrane; regulation of cell shape; transferase activity, transferring pentosyl groups
GO identifier : GO:0016021; GO:0009252; GO:0009274; GO:0005886; GO:0008360; GO:0016763
Keywords
Ligand & Biological process : Cell membrane; Cell shape; Cell wall biogenesis/degradation; Complete proteome; Glycosyltransferase; Membrane; Peptidoglycan synthesis; Transferase; Transmembrane; Transmembrane helix
General annotation
Pathway : Cell wall biogenesis; peptidoglycan biosynthesis.
Subcellular location : Cell membrane; Single-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 210 residues
>Q4QM69|Q4QM69_HAEI8 Haemophilus influenzae 86-028NP
MVQQKIANLLQGDFRYQIQYNWVSLENISPNIQLAVISSEDQRFFEHLGFDFEAIQRAIR
YNEKSNKGIRGASTISQQTAKNLMLWHGQNWLRKGLEVPATMLLELTWSKKRILEVYLNI
AEFGNGIFGVEAASRYYFKKSAKNLSQNEAALLAAVLPNPIIYKVNKPSLLVRKKQTWIL
RQMGNLGTEYLSDL