HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QM68

Names and origin
Entry : Q4QM68 (reviewed)
Entry name : FRDD_HAEI8
Protein names : Fumarate reductase subunit D
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : frdD
ORF names : NTHI0998
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : fumarate metabolic process; integral to membrane; plasma membrane
GO identifier : GO:0006106; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FrdD family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 122 residues
>Q4QM68|FRDD_HAEI8 Haemophilus influenzae 86-028NP
MVDQNPKRSGEPPVWLMFGAGGTVSAIFLPVVILIIGLLLPFGLVDAHNLITFAYSWIGK
LVILVLTIFPMWCGLHRIHHGMHDLKVHVPAGGFIFYGLATIYTVWVLFAVINL