HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QM44

Names and origin
Entry : Q4QM44 (reviewed)
Entry name : ZAPA_HAEI8
Protein names : Cell division protein ZapA (Z ring-associated protein ZapA)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : zapA
ORF names : NTHI1025
History
Date of creation : 2008-09-02
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytoplasm
GO identifier : GO:0000917; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapA family, Type 1 subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 108 residues
>Q4QM44|ZAPA_HAEI8 Haemophilus influenzae 86-028NP
MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKTGLIQLDRVLSIVALN
LSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPH