HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QM17

Names and origin
Entry : Q4QM17 (reviewed)
Entry name : YACG_HAEI8
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : yacG
ORF names : NTHI1056
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA topoisomerase (ATP-hydrolyzing) inhibitor activity; negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity; regulation of transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0008657; GO:2000372; GO:0006355; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Reference
PubMed ID : 15968074
Protein sequence
Length : 76 residues
>Q4QM17|YACG_HAEI8 Haemophilus influenzae 86-028NP
MPDEMIEVPCPICQKSVPWINESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDPN
VSDGWSIK