HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QLT0

Names and origin
Entry : Q4QLT0 (reviewed)
Entry name : FIS_HAEI8
Protein names : DNA-binding protein fis
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : fis
ORF names : NTHI1152
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Activator; Complete proteome; DNA-binding; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to Transcriptional regulatory fis family
Reference
PubMed ID : 15968074
Protein sequence
Length : 107 residues
>Q4QLT0|FIS_HAEI8 Haemophilus influenzae 86-028NP
MLEQQRNPADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLDGQDVNDLYELVLAEVE
HPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG