HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QLR1

Names and origin
Entry : Q4QLR1 (reviewed)
Entry name : YIDD_HAEI8
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI1174
History
Date of creation : 2006-10-17
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.
Reference
PubMed ID : 15968074
Protein sequence
Length : 94 residues
>Q4QLR1|YIDD_HAEI8 Haemophilus influenzae 86-028NP
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK