HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QLQ1

Names and origin
Entry : Q4QLQ1 (reviewed)
Entry name : THIQ_HAEI8
Protein names : Thiamine import ATP-binding protein ThiQ (EC 3.6.3.-)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : thiQ
ORF names : NTHI1187
EC number : 3.6.3.-
History
Date of creation : 2007-02-06
Date of modification : 2013-11-13
Date of sequence modification : 2007-02-06
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity, coupled to transmembrane movement of substances; integral to membrane; plasma membrane
GO identifier : GO:0005524; GO:0006200; GO:0042626; GO:0016021; GO:0005886
Keywords
Ligand & Biological process : ATP-binding; Cell inner membrane; Cell membrane; Complete proteome; Hydrolase; Membrane; Nucleotide-binding; Transport
General annotation
Domains : ABC transporter domain (1)
Sequence similarities : Belongs to ABC transporter superfamily, Thiamine importer (TC 3.A.1.19.1) family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Reference
PubMed ID : 15968074
Protein sequence
Length : 231 residues
>Q4QLQ1|THIQ_HAEI8 Haemophilus influenzae 86-028NP
MIYLNNVILNDKTLPMCFNLNVKAGERVAIIGESGAGKSTLLNLIAGFEFPAQGEIWLND
KNHTRSAPYERPVSMLFQENNLFPHLTVQQNLALGIKPSLKLTALEQEKIEQAACSVGLG
DYLERLPNSLSGGQKQRVALARCLLRDKPILLLDEPFSALDQKLRVEMLALIAKLCDEKD
LTLLLVTHQPSELIGSIDQVLVVENGQISQLQKGV