HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QLJ5

Names and origin
Entry : Q4QLJ5 (reviewed)
Entry name : CCME_HAEI8
Protein names : Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : ccmE
ORF names : cycJ
History
Date of creation : 2006-05-30
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytochrome complex assembly; integral to membrane; metal ion binding; plasma membrane; protein-heme linkage
GO identifier : GO:0017004; GO:0016021; GO:0046872; GO:0005886; GO:0017003
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Heme; Iron; Membrane; Metal-binding; Signal-anchor; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to CcmE/CycJ family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.
Reference
PubMed ID : 15968074
Protein sequence
Length : 185 residues
>Q4QLJ5|CCME_HAEI8 Haemophilus influenzae 86-028NP
MNPRRKSRFKLVIFVVLGIAIASGLMLYALRQNIDLFYTPSEVIQGKDNNPNQKPEVGQR
IRVGGMVVEGTVVRDPKSLKVRFDLNDIGPAITVEYEGILPDLFREGQGIVAQGVLTQSA
VLSATEVLAKHDENYVPPELGEKMQKVHKPMGIKAADLKGESERDRQEKEGAK