HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QLD2

Names and origin
Entry : Q4QLD2 (reviewed)
Entry name : GLRX4_HAEI8
Protein names : Glutaredoxin-4 (Grx4) (Monothiol glutaredoxin)
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : grxD
ORF names : NTHI1333
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; cell redox homeostasis; cytoplasm; electron carrier activity; metal ion binding; protein disulfide oxidoreductase activity
GO identifier : GO:0051537; GO:0045454; GO:0005737; GO:0009055; GO:0046872; GO:0015035
Keywords
Ligand & Biological process : 2Fe-2S; Complete proteome; Cytoplasm; Iron; Iron-sulfur; Metal-binding; Redox-active center
General annotation
Domains : Glutaredoxin domain (1)
Sequence similarities : Belongs to Glutaredoxin family, Monothiol subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 15968074
Protein sequence
Length : 115 residues
>Q4QLD2|GLRX4_HAEI8 Haemophilus influenzae 86-028NP
METLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFGYVDILQHPDIRAE
LPTYANWPTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKHA