HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QKT0

Names and origin
Entry : Q4QKT0 (unreviewed)
Entry name : Q4QKT0_HAEI8
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI1563
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : DNA repair; DNA-directed DNA polymerase activity; damaged DNA binding
GO identifier : GO:0006281; GO:0003887; GO:0003684
Keywords
Ligand & Biological process : Complete proteome
Reference
PubMed ID : 15968074
Protein sequence
Length : 52 residues
>Q4QKT0|Q4QKT0_HAEI8 Haemophilus influenzae 86-028NP
MHEYTPLNFKNQQLLPQIFMRAKGRSIRLIGLHVNLPEENKQEQMSLW