HIGDB - Haemophilus influenzae Genome Database

Protein search results for - Q4QKM6

Names and origin
Entry : Q4QKM6 (unreviewed)
Entry name : Q4QKM6_HAEI8
Protein names : Conserved hypothetical ferredoxin-like protein
Organism : Haemophilus influenzae 86-028NP
Organism ID : 281310
Gene names : NTHI1622
History
Date of creation : 2005-07-19
Date of modification : 2013-11-13
Date of sequence modification : 2005-07-19
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : 2Fe-2S; Complete proteome; Iron; Iron-sulfur; Metal-binding
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Reference
PubMed ID : 15968074
Protein sequence
Length : 90 residues
>Q4QKM6|Q4QKM6_HAEI8 Haemophilus influenzae 86-028NP
MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRSGYCGSCRVKIKKGKVSYKEMPLA
FIQPDEILLCCCHVESDLEIDL